Anti ABHD5 pAb (ATL-HPA035851 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA035851-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 5
Gene Name: ABHD5
Alternative Gene Name: CGI-58, NCIE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032540: 88%, ENSRNOG00000000221: 87%
Entrez Gene ID: 51099
Uniprot ID: Q8WTS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSHNISNKTPLVLLHG
Gene Sequence MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSHNISNKTPLVLLHG
Gene ID - Mouse ENSMUSG00000032540
Gene ID - Rat ENSRNOG00000000221
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABHD5 pAb (ATL-HPA035851 w/enhanced validation)
Datasheet Anti ABHD5 pAb (ATL-HPA035851 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABHD5 pAb (ATL-HPA035851 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ABHD5 pAb (ATL-HPA035851 w/enhanced validation)
Datasheet Anti ABHD5 pAb (ATL-HPA035851 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABHD5 pAb (ATL-HPA035851 w/enhanced validation)