Anti ABHD5 pAb (ATL-HPA035851 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035851-25

• 
• 
• 

Protein Description: abhydrolase domain containing 5
Gene Name: ABHD5
Alternative Gene Name: CGI-58, NCIE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032540: 88%, ENSRNOG00000000221: 87%
Entrez Gene ID: 51099
Uniprot ID: Q8WTS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSHNISNKTPLVLLHG
• Gene Sequence: MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSHNISNKTPLVLLHG
• Gene ID - Mouse: ENSMUSG00000032540
• Gene ID - Rat: ENSRNOG00000000221
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.