Anti ABHD4 pAb (ATL-HPA000600)

Atlas Antibodies

SKU:
ATL-HPA000600-25
  • Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ABHD4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411808).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 4
Gene Name: ABHD4
Alternative Gene Name: FLJ12816
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040997: 97%, ENSRNOG00000009244: 97%
Entrez Gene ID: 63874
Uniprot ID: Q8TB40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGF
Gene Sequence ADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGF
Gene ID - Mouse ENSMUSG00000040997
Gene ID - Rat ENSRNOG00000009244
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ABHD4 pAb (ATL-HPA000600)
Datasheet Anti ABHD4 pAb (ATL-HPA000600) Datasheet (External Link)
Vendor Page Anti ABHD4 pAb (ATL-HPA000600) at Atlas Antibodies

Documents & Links for Anti ABHD4 pAb (ATL-HPA000600)
Datasheet Anti ABHD4 pAb (ATL-HPA000600) Datasheet (External Link)
Vendor Page Anti ABHD4 pAb (ATL-HPA000600)