Anti ABHD18 pAb (ATL-HPA050168)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050168-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ABHD18
Alternative Gene Name: C4orf29, FLJ21106
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037818: 86%, ENSRNOG00000013692: 88%
Entrez Gene ID: 80167
Uniprot ID: Q0P651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NKSGYTSRNPQSYHLLSKEQSRNSLRKESLIFMKGVMDECTHVANFSVPVDPSLIIVVQAKEDAYIPRTGVRSLQEIWPGCEIRYL |
| Gene Sequence | NKSGYTSRNPQSYHLLSKEQSRNSLRKESLIFMKGVMDECTHVANFSVPVDPSLIIVVQAKEDAYIPRTGVRSLQEIWPGCEIRYL |
| Gene ID - Mouse | ENSMUSG00000037818 |
| Gene ID - Rat | ENSRNOG00000013692 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABHD18 pAb (ATL-HPA050168) | |
| Datasheet | Anti ABHD18 pAb (ATL-HPA050168) Datasheet (External Link) |
| Vendor Page | Anti ABHD18 pAb (ATL-HPA050168) at Atlas Antibodies |
| Documents & Links for Anti ABHD18 pAb (ATL-HPA050168) | |
| Datasheet | Anti ABHD18 pAb (ATL-HPA050168) Datasheet (External Link) |
| Vendor Page | Anti ABHD18 pAb (ATL-HPA050168) |