Anti ABHD17A pAb (ATL-HPA047226)

Atlas Antibodies

Catalog No.:
ATL-HPA047226-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 17A
Gene Name: ABHD17A
Alternative Gene Name: C19orf27, FAM108A1, MGC5244
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053536: 31%, ENSRNOG00000050289: 31%
Entrez Gene ID: 81926
Uniprot ID: Q96GS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARQGHQAQGGHPQLAWVGRLGDSNNPAPGGCLLGESWGTGAALACGYIHLLARYT
Gene Sequence ARQGHQAQGGHPQLAWVGRLGDSNNPAPGGCLLGESWGTGAALACGYIHLLARYT
Gene ID - Mouse ENSMUSG00000053536
Gene ID - Rat ENSRNOG00000050289
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABHD17A pAb (ATL-HPA047226)
Datasheet Anti ABHD17A pAb (ATL-HPA047226) Datasheet (External Link)
Vendor Page Anti ABHD17A pAb (ATL-HPA047226) at Atlas Antibodies

Documents & Links for Anti ABHD17A pAb (ATL-HPA047226)
Datasheet Anti ABHD17A pAb (ATL-HPA047226) Datasheet (External Link)
Vendor Page Anti ABHD17A pAb (ATL-HPA047226)