Anti ABHD17A pAb (ATL-HPA043270 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043270-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: ABHD17A
Alternative Gene Name: C19orf27, FAM108A1, MGC5244
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003346: 87%, ENSRNOG00000018212: 87%
Entrez Gene ID: 81926
Uniprot ID: Q96GS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LDTIEVFPTKSARGNRVSCMYVRCVPGARY |
Gene Sequence | LDTIEVFPTKSARGNRVSCMYVRCVPGARY |
Gene ID - Mouse | ENSMUSG00000003346 |
Gene ID - Rat | ENSRNOG00000018212 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABHD17A pAb (ATL-HPA043270 w/enhanced validation) | |
Datasheet | Anti ABHD17A pAb (ATL-HPA043270 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ABHD17A pAb (ATL-HPA043270 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ABHD17A pAb (ATL-HPA043270 w/enhanced validation) | |
Datasheet | Anti ABHD17A pAb (ATL-HPA043270 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ABHD17A pAb (ATL-HPA043270 w/enhanced validation) |