Anti ABHD17A pAb (ATL-HPA043270 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA043270-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 17A
Gene Name: ABHD17A
Alternative Gene Name: C19orf27, FAM108A1, MGC5244
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003346: 87%, ENSRNOG00000018212: 87%
Entrez Gene ID: 81926
Uniprot ID: Q96GS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDTIEVFPTKSARGNRVSCMYVRCVPGARY
Gene Sequence LDTIEVFPTKSARGNRVSCMYVRCVPGARY
Gene ID - Mouse ENSMUSG00000003346
Gene ID - Rat ENSRNOG00000018212
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABHD17A pAb (ATL-HPA043270 w/enhanced validation)
Datasheet Anti ABHD17A pAb (ATL-HPA043270 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABHD17A pAb (ATL-HPA043270 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ABHD17A pAb (ATL-HPA043270 w/enhanced validation)
Datasheet Anti ABHD17A pAb (ATL-HPA043270 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABHD17A pAb (ATL-HPA043270 w/enhanced validation)