Anti ABHD16B pAb (ATL-HPA059272)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059272-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ABHD16B
Alternative Gene Name: C20orf135, dJ591C20.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055882: 73%, ENSRNOG00000015067: 65%
Entrez Gene ID: 140701
Uniprot ID: Q9H3Z7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VVMAREGRAVVTRWLRAGSLAQEAAFYARYRVDEDWCLALLRSYRARCEEELEGEEALGPHGPAFPWLVGQ |
| Gene Sequence | VVMAREGRAVVTRWLRAGSLAQEAAFYARYRVDEDWCLALLRSYRARCEEELEGEEALGPHGPAFPWLVGQ |
| Gene ID - Mouse | ENSMUSG00000055882 |
| Gene ID - Rat | ENSRNOG00000015067 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABHD16B pAb (ATL-HPA059272) | |
| Datasheet | Anti ABHD16B pAb (ATL-HPA059272) Datasheet (External Link) |
| Vendor Page | Anti ABHD16B pAb (ATL-HPA059272) at Atlas Antibodies |
| Documents & Links for Anti ABHD16B pAb (ATL-HPA059272) | |
| Datasheet | Anti ABHD16B pAb (ATL-HPA059272) Datasheet (External Link) |
| Vendor Page | Anti ABHD16B pAb (ATL-HPA059272) |