Anti ABHD16B pAb (ATL-HPA059272)

Atlas Antibodies

Catalog No.:
ATL-HPA059272-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 16B
Gene Name: ABHD16B
Alternative Gene Name: C20orf135, dJ591C20.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055882: 73%, ENSRNOG00000015067: 65%
Entrez Gene ID: 140701
Uniprot ID: Q9H3Z7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVMAREGRAVVTRWLRAGSLAQEAAFYARYRVDEDWCLALLRSYRARCEEELEGEEALGPHGPAFPWLVGQ
Gene Sequence VVMAREGRAVVTRWLRAGSLAQEAAFYARYRVDEDWCLALLRSYRARCEEELEGEEALGPHGPAFPWLVGQ
Gene ID - Mouse ENSMUSG00000055882
Gene ID - Rat ENSRNOG00000015067
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABHD16B pAb (ATL-HPA059272)
Datasheet Anti ABHD16B pAb (ATL-HPA059272) Datasheet (External Link)
Vendor Page Anti ABHD16B pAb (ATL-HPA059272) at Atlas Antibodies

Documents & Links for Anti ABHD16B pAb (ATL-HPA059272)
Datasheet Anti ABHD16B pAb (ATL-HPA059272) Datasheet (External Link)
Vendor Page Anti ABHD16B pAb (ATL-HPA059272)