Anti ABHD14B pAb (ATL-HPA036642)

Atlas Antibodies

Catalog No.:
ATL-HPA036642-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 14B
Gene Name: ABHD14B
Alternative Gene Name: CIB, MGC15429
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042073: 80%, ENSRNOG00000012073: 83%
Entrez Gene ID: 84836
Uniprot ID: Q96IU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAV
Gene Sequence MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAV
Gene ID - Mouse ENSMUSG00000042073
Gene ID - Rat ENSRNOG00000012073
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABHD14B pAb (ATL-HPA036642)
Datasheet Anti ABHD14B pAb (ATL-HPA036642) Datasheet (External Link)
Vendor Page Anti ABHD14B pAb (ATL-HPA036642) at Atlas Antibodies

Documents & Links for Anti ABHD14B pAb (ATL-HPA036642)
Datasheet Anti ABHD14B pAb (ATL-HPA036642) Datasheet (External Link)
Vendor Page Anti ABHD14B pAb (ATL-HPA036642)