Anti ABHD14B pAb (ATL-HPA036642)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036642-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: ABHD14B
Alternative Gene Name: CIB, MGC15429
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042073: 80%, ENSRNOG00000012073: 83%
Entrez Gene ID: 84836
Uniprot ID: Q96IU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAV |
Gene Sequence | MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAV |
Gene ID - Mouse | ENSMUSG00000042073 |
Gene ID - Rat | ENSRNOG00000012073 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABHD14B pAb (ATL-HPA036642) | |
Datasheet | Anti ABHD14B pAb (ATL-HPA036642) Datasheet (External Link) |
Vendor Page | Anti ABHD14B pAb (ATL-HPA036642) at Atlas Antibodies |
Documents & Links for Anti ABHD14B pAb (ATL-HPA036642) | |
Datasheet | Anti ABHD14B pAb (ATL-HPA036642) Datasheet (External Link) |
Vendor Page | Anti ABHD14B pAb (ATL-HPA036642) |