Anti ABHD14B pAb (ATL-HPA036444)

Atlas Antibodies

Catalog No.:
ATL-HPA036444-25
Immunohistochemical staining of human pancreas shows strong cytoplasmic and nuclear positivity in exocrine glandular cells and islet cells.
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & cytosol.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 14B
Gene Name: ABHD14B
Alternative Gene Name: CIB, MGC15429
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042073: 87%, ENSRNOG00000012073: 87%
Entrez Gene ID: 84836
Uniprot ID: Q96IU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFL
Gene Sequence PICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFL
Gene ID - Mouse ENSMUSG00000042073
Gene ID - Rat ENSRNOG00000012073
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABHD14B pAb (ATL-HPA036444)
Datasheet Anti ABHD14B pAb (ATL-HPA036444) Datasheet (External Link)
Vendor Page Anti ABHD14B pAb (ATL-HPA036444) at Atlas Antibodies

Documents & Links for Anti ABHD14B pAb (ATL-HPA036444)
Datasheet Anti ABHD14B pAb (ATL-HPA036444) Datasheet (External Link)
Vendor Page Anti ABHD14B pAb (ATL-HPA036444)
!