Anti ABHD14B pAb (ATL-HPA036444)

Atlas Antibodies

SKU: ATL-HPA036444-25

• 
• 
• 

Protein Description: abhydrolase domain containing 14B
Gene Name: ABHD14B
Alternative Gene Name: CIB, MGC15429
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042073: 87%, ENSRNOG00000012073: 87%
Entrez Gene ID: 84836
Uniprot ID: Q96IU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFL
• Gene Sequence: PICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFL
• Gene ID - Mouse: ENSMUSG00000042073
• Gene ID - Rat: ENSRNOG00000012073
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.