Anti ABHD14A pAb (ATL-HPA038153)

Atlas Antibodies

Catalog No.:
ATL-HPA038153-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 14A
Gene Name: ABHD14A
Alternative Gene Name: DKFZP564O243, DORZ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042210: 81%, ENSRNOG00000011936: 78%
Entrez Gene ID: 25864
Uniprot ID: Q9BUJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEQTSCLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQL
Gene Sequence PEQTSCLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQL
Gene ID - Mouse ENSMUSG00000042210
Gene ID - Rat ENSRNOG00000011936
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABHD14A pAb (ATL-HPA038153)
Datasheet Anti ABHD14A pAb (ATL-HPA038153) Datasheet (External Link)
Vendor Page Anti ABHD14A pAb (ATL-HPA038153) at Atlas Antibodies

Documents & Links for Anti ABHD14A pAb (ATL-HPA038153)
Datasheet Anti ABHD14A pAb (ATL-HPA038153) Datasheet (External Link)
Vendor Page Anti ABHD14A pAb (ATL-HPA038153)