Anti ABHD13 pAb (ATL-HPA032143 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA032143-25
  • Immunohistochemical staining of human cerebellum shows distinct cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ABHD13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409893).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 13
Gene Name: ABHD13
Alternative Gene Name: bA153I24.2, BEM46L1, C13orf6, FLJ14906
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040396: 99%, ENSRNOG00000014598: 99%
Entrez Gene ID: 84945
Uniprot ID: Q7L211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVVK
Gene Sequence MRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVVK
Gene ID - Mouse ENSMUSG00000040396
Gene ID - Rat ENSRNOG00000014598
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ABHD13 pAb (ATL-HPA032143 w/enhanced validation)
Datasheet Anti ABHD13 pAb (ATL-HPA032143 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABHD13 pAb (ATL-HPA032143 w/enhanced validation)