Anti ABHD12B pAb (ATL-HPA002873)

Atlas Antibodies

Catalog No.:
ATL-HPA002873-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 12B
Gene Name: ABHD12B
Alternative Gene Name: BEM46L3, C14orf29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090121: 80%, ENSRNOG00000036934: 44%
Entrez Gene ID: 145447
Uniprot ID: Q7Z5M8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIVFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQ
Gene Sequence LGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIVFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQ
Gene ID - Mouse ENSMUSG00000090121
Gene ID - Rat ENSRNOG00000036934
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABHD12B pAb (ATL-HPA002873)
Datasheet Anti ABHD12B pAb (ATL-HPA002873) Datasheet (External Link)
Vendor Page Anti ABHD12B pAb (ATL-HPA002873) at Atlas Antibodies

Documents & Links for Anti ABHD12B pAb (ATL-HPA002873)
Datasheet Anti ABHD12B pAb (ATL-HPA002873) Datasheet (External Link)
Vendor Page Anti ABHD12B pAb (ATL-HPA002873)