Anti ABHD12B pAb (ATL-HPA002873)
Atlas Antibodies
- SKU:
- ATL-HPA002873-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ABHD12B
Alternative Gene Name: BEM46L3, C14orf29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090121: 80%, ENSRNOG00000036934: 44%
Entrez Gene ID: 145447
Uniprot ID: Q7Z5M8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIVFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQ |
Gene Sequence | LGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIVFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQ |
Gene ID - Mouse | ENSMUSG00000090121 |
Gene ID - Rat | ENSRNOG00000036934 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABHD12B pAb (ATL-HPA002873) | |
Datasheet | Anti ABHD12B pAb (ATL-HPA002873) Datasheet (External Link) |
Vendor Page | Anti ABHD12B pAb (ATL-HPA002873) at Atlas Antibodies |
Documents & Links for Anti ABHD12B pAb (ATL-HPA002873) | |
Datasheet | Anti ABHD12B pAb (ATL-HPA002873) Datasheet (External Link) |
Vendor Page | Anti ABHD12B pAb (ATL-HPA002873) |