Anti ABHD10 pAb (ATL-HPA066081)

Atlas Antibodies

Catalog No.:
ATL-HPA066081-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 10
Gene Name: ABHD10
Alternative Gene Name: FLJ11342
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033157: 78%, ENSRNOG00000043107: 75%
Entrez Gene ID: 55347
Uniprot ID: Q9NUJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STLGKWRKDVLSIIDDLADGPQILVGSSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMKGVWSM
Gene Sequence STLGKWRKDVLSIIDDLADGPQILVGSSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMKGVWSM
Gene ID - Mouse ENSMUSG00000033157
Gene ID - Rat ENSRNOG00000043107
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABHD10 pAb (ATL-HPA066081)
Datasheet Anti ABHD10 pAb (ATL-HPA066081) Datasheet (External Link)
Vendor Page Anti ABHD10 pAb (ATL-HPA066081) at Atlas Antibodies

Documents & Links for Anti ABHD10 pAb (ATL-HPA066081)
Datasheet Anti ABHD10 pAb (ATL-HPA066081) Datasheet (External Link)
Vendor Page Anti ABHD10 pAb (ATL-HPA066081)