Anti ABHD10 pAb (ATL-HPA036992)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036992-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ABHD10
Alternative Gene Name: FLJ11342
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033157: 80%, ENSRNOG00000043107: 75%
Entrez Gene ID: 55347
Uniprot ID: Q9NUJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLARIPQRAPRWLPACRQKTSLSFLNRPDLPNLAYKKLKGKSPGIIFIPGYLSYMNGTKALAIEEFCKSLGHACIRFDYSGVGSSDG |
| Gene Sequence | LLARIPQRAPRWLPACRQKTSLSFLNRPDLPNLAYKKLKGKSPGIIFIPGYLSYMNGTKALAIEEFCKSLGHACIRFDYSGVGSSDG |
| Gene ID - Mouse | ENSMUSG00000033157 |
| Gene ID - Rat | ENSRNOG00000043107 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABHD10 pAb (ATL-HPA036992) | |
| Datasheet | Anti ABHD10 pAb (ATL-HPA036992) Datasheet (External Link) |
| Vendor Page | Anti ABHD10 pAb (ATL-HPA036992) at Atlas Antibodies |
| Documents & Links for Anti ABHD10 pAb (ATL-HPA036992) | |
| Datasheet | Anti ABHD10 pAb (ATL-HPA036992) Datasheet (External Link) |
| Vendor Page | Anti ABHD10 pAb (ATL-HPA036992) |