Anti ABHD1 pAb (ATL-HPA044390)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044390-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ABHD1
Alternative Gene Name: FLJ36128, LABH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002475: 47%, ENSRNOG00000025689: 80%
Entrez Gene ID: 84696
Uniprot ID: Q96SE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FLEPHCSITTETFYPTLWCFEGRLQSIFQVLLQSQPLVLYQSDILQTPDGGQLLLDWAKQPDSSQDPDPTTQPIVLLLPGITGSSQETYVLHLVNQALRDGYQAVVFNNRGCRGEELRTHR |
| Gene Sequence | FLEPHCSITTETFYPTLWCFEGRLQSIFQVLLQSQPLVLYQSDILQTPDGGQLLLDWAKQPDSSQDPDPTTQPIVLLLPGITGSSQETYVLHLVNQALRDGYQAVVFNNRGCRGEELRTHR |
| Gene ID - Mouse | ENSMUSG00000002475 |
| Gene ID - Rat | ENSRNOG00000025689 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABHD1 pAb (ATL-HPA044390) | |
| Datasheet | Anti ABHD1 pAb (ATL-HPA044390) Datasheet (External Link) |
| Vendor Page | Anti ABHD1 pAb (ATL-HPA044390) at Atlas Antibodies |
| Documents & Links for Anti ABHD1 pAb (ATL-HPA044390) | |
| Datasheet | Anti ABHD1 pAb (ATL-HPA044390) Datasheet (External Link) |
| Vendor Page | Anti ABHD1 pAb (ATL-HPA044390) |