Anti ABHD1 pAb (ATL-HPA044390)

Atlas Antibodies

Catalog No.:
ATL-HPA044390-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 1
Gene Name: ABHD1
Alternative Gene Name: FLJ36128, LABH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002475: 47%, ENSRNOG00000025689: 80%
Entrez Gene ID: 84696
Uniprot ID: Q96SE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLEPHCSITTETFYPTLWCFEGRLQSIFQVLLQSQPLVLYQSDILQTPDGGQLLLDWAKQPDSSQDPDPTTQPIVLLLPGITGSSQETYVLHLVNQALRDGYQAVVFNNRGCRGEELRTHR
Gene Sequence FLEPHCSITTETFYPTLWCFEGRLQSIFQVLLQSQPLVLYQSDILQTPDGGQLLLDWAKQPDSSQDPDPTTQPIVLLLPGITGSSQETYVLHLVNQALRDGYQAVVFNNRGCRGEELRTHR
Gene ID - Mouse ENSMUSG00000002475
Gene ID - Rat ENSRNOG00000025689
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABHD1 pAb (ATL-HPA044390)
Datasheet Anti ABHD1 pAb (ATL-HPA044390) Datasheet (External Link)
Vendor Page Anti ABHD1 pAb (ATL-HPA044390) at Atlas Antibodies

Documents & Links for Anti ABHD1 pAb (ATL-HPA044390)
Datasheet Anti ABHD1 pAb (ATL-HPA044390) Datasheet (External Link)
Vendor Page Anti ABHD1 pAb (ATL-HPA044390)