Anti ABHD1 pAb (ATL-HPA044390)
Atlas Antibodies
- SKU:
- ATL-HPA044390-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ABHD1
Alternative Gene Name: FLJ36128, LABH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002475: 47%, ENSRNOG00000025689: 80%
Entrez Gene ID: 84696
Uniprot ID: Q96SE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FLEPHCSITTETFYPTLWCFEGRLQSIFQVLLQSQPLVLYQSDILQTPDGGQLLLDWAKQPDSSQDPDPTTQPIVLLLPGITGSSQETYVLHLVNQALRDGYQAVVFNNRGCRGEELRTHR |
Gene Sequence | FLEPHCSITTETFYPTLWCFEGRLQSIFQVLLQSQPLVLYQSDILQTPDGGQLLLDWAKQPDSSQDPDPTTQPIVLLLPGITGSSQETYVLHLVNQALRDGYQAVVFNNRGCRGEELRTHR |
Gene ID - Mouse | ENSMUSG00000002475 |
Gene ID - Rat | ENSRNOG00000025689 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABHD1 pAb (ATL-HPA044390) | |
Datasheet | Anti ABHD1 pAb (ATL-HPA044390) Datasheet (External Link) |
Vendor Page | Anti ABHD1 pAb (ATL-HPA044390) at Atlas Antibodies |
Documents & Links for Anti ABHD1 pAb (ATL-HPA044390) | |
Datasheet | Anti ABHD1 pAb (ATL-HPA044390) Datasheet (External Link) |
Vendor Page | Anti ABHD1 pAb (ATL-HPA044390) |