Anti ABCG5 pAb (ATL-HPA016514)

Atlas Antibodies

SKU: ATL-HPA016514-25

• 

Protein Description: ATP-binding cassette, sub-family G (WHITE), member 5
Gene Name: ABCG5
Alternative Gene Name: STSL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040505: 81%, ENSRNOG00000005250: 81%
Entrez Gene ID: 64240
Uniprot ID: Q9H222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IHQPRSELFQLFDKIAILSFGELIFCGTPAEMLDFFNDCGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICHKTLKNIERMKHLKTLPMVPFKTKDSPGVFSKLGVLL
• Gene Sequence: IHQPRSELFQLFDKIAILSFGELIFCGTPAEMLDFFNDCGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICHKTLKNIERMKHLKTLPMVPFKTKDSPGVFSKLGVLL
• Gene ID - Mouse: ENSMUSG00000040505
• Gene ID - Rat: ENSRNOG00000005250
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.