Anti ABCG4 pAb (ATL-HPA040312)

Atlas Antibodies

SKU: ATL-HPA040312-25

• 

Protein Description: ATP-binding cassette, sub-family G (WHITE), member 4
Gene Name: ABCG4
Alternative Gene Name: WHITE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032131: 88%, ENSRNOG00000008862: 92%
Entrez Gene ID: 64137
Uniprot ID: Q9H172
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDPIESHTFATSTLT
• Gene Sequence: NPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDPIESHTFATSTLT
• Gene ID - Mouse: ENSMUSG00000032131
• Gene ID - Rat: ENSRNOG00000008862
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.