Anti ABCG4 pAb (ATL-HPA040312)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040312-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ABCG4
Alternative Gene Name: WHITE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032131: 88%, ENSRNOG00000008862: 92%
Entrez Gene ID: 64137
Uniprot ID: Q9H172
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDPIESHTFATSTLT |
| Gene Sequence | NPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDPIESHTFATSTLT |
| Gene ID - Mouse | ENSMUSG00000032131 |
| Gene ID - Rat | ENSRNOG00000008862 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABCG4 pAb (ATL-HPA040312) | |
| Datasheet | Anti ABCG4 pAb (ATL-HPA040312) Datasheet (External Link) |
| Vendor Page | Anti ABCG4 pAb (ATL-HPA040312) at Atlas Antibodies |
| Documents & Links for Anti ABCG4 pAb (ATL-HPA040312) | |
| Datasheet | Anti ABCG4 pAb (ATL-HPA040312) Datasheet (External Link) |
| Vendor Page | Anti ABCG4 pAb (ATL-HPA040312) |