Anti ABCG1 pAb (ATL-HPA031471)

Atlas Antibodies

SKU: ATL-HPA031471-25

• 
• 

Protein Description: ATP-binding cassette, sub-family G (WHITE), member 1
Gene Name: ABCG1
Alternative Gene Name: ABC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024030: 75%, ENSRNOG00000001158: 75%
Entrez Gene ID: 9619
Uniprot ID: P45844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EYGDQNSRLVRAVREGMCDSDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCL
• Gene Sequence: EYGDQNSRLVRAVREGMCDSDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCL
• Gene ID - Mouse: ENSMUSG00000024030
• Gene ID - Rat: ENSRNOG00000001158
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.