Anti ABCG1 pAb (ATL-HPA031470)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031470-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ABCG1
Alternative Gene Name: ABC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024030: 90%, ENSRNOG00000001158: 90%
Entrez Gene ID: 9619
Uniprot ID: P45844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEG |
| Gene Sequence | AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEG |
| Gene ID - Mouse | ENSMUSG00000024030 |
| Gene ID - Rat | ENSRNOG00000001158 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABCG1 pAb (ATL-HPA031470) | |
| Datasheet | Anti ABCG1 pAb (ATL-HPA031470) Datasheet (External Link) |
| Vendor Page | Anti ABCG1 pAb (ATL-HPA031470) at Atlas Antibodies |
| Documents & Links for Anti ABCG1 pAb (ATL-HPA031470) | |
| Datasheet | Anti ABCG1 pAb (ATL-HPA031470) Datasheet (External Link) |
| Vendor Page | Anti ABCG1 pAb (ATL-HPA031470) |
| Citations for Anti ABCG1 pAb (ATL-HPA031470) – 1 Found |
| Andersson, Sandra; Konrad, Anna; Ashok, Nikhil; Pontén, Fredrik; Hober, Sophia; Asplund, Anna. Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(11):773-84. PubMed |