Anti ABCG1 pAb (ATL-HPA031470)

Atlas Antibodies

SKU: ATL-HPA031470-25

• 

Protein Description: ATP-binding cassette, sub-family G (WHITE), member 1
Gene Name: ABCG1
Alternative Gene Name: ABC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024030: 90%, ENSRNOG00000001158: 90%
Entrez Gene ID: 9619
Uniprot ID: P45844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEG
• Gene Sequence: AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEG
• Gene ID - Mouse: ENSMUSG00000024030
• Gene ID - Rat: ENSRNOG00000001158
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ABCG1 pAb (ATL-HPA031470) – 1 Found

Andersson, Sandra; Konrad, Anna; Ashok, Nikhil; Pontén, Fredrik; Hober, Sophia; Asplund, Anna. Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(11):773-84.