Anti ABCG1 pAb (ATL-HPA031470)

Atlas Antibodies

Catalog No.:
ATL-HPA031470-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family G (WHITE), member 1
Gene Name: ABCG1
Alternative Gene Name: ABC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024030: 90%, ENSRNOG00000001158: 90%
Entrez Gene ID: 9619
Uniprot ID: P45844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEG
Gene Sequence AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEG
Gene ID - Mouse ENSMUSG00000024030
Gene ID - Rat ENSRNOG00000001158
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABCG1 pAb (ATL-HPA031470)
Datasheet Anti ABCG1 pAb (ATL-HPA031470) Datasheet (External Link)
Vendor Page Anti ABCG1 pAb (ATL-HPA031470) at Atlas Antibodies

Documents & Links for Anti ABCG1 pAb (ATL-HPA031470)
Datasheet Anti ABCG1 pAb (ATL-HPA031470) Datasheet (External Link)
Vendor Page Anti ABCG1 pAb (ATL-HPA031470)
Citations for Anti ABCG1 pAb (ATL-HPA031470) – 1 Found
Andersson, Sandra; Konrad, Anna; Ashok, Nikhil; Pontén, Fredrik; Hober, Sophia; Asplund, Anna. Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(11):773-84.  PubMed