Anti ABCF3 pAb (ATL-HPA036332)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036332-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ABCF3
Alternative Gene Name: EST201864
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003234: 96%, ENSRNOG00000001710: 95%
Entrez Gene ID: 55324
Uniprot ID: Q9NUQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FESVDDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLLDAPIQLSKITENYDCGTKLPGLL |
Gene Sequence | FESVDDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLLDAPIQLSKITENYDCGTKLPGLL |
Gene ID - Mouse | ENSMUSG00000003234 |
Gene ID - Rat | ENSRNOG00000001710 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABCF3 pAb (ATL-HPA036332) | |
Datasheet | Anti ABCF3 pAb (ATL-HPA036332) Datasheet (External Link) |
Vendor Page | Anti ABCF3 pAb (ATL-HPA036332) at Atlas Antibodies |
Documents & Links for Anti ABCF3 pAb (ATL-HPA036332) | |
Datasheet | Anti ABCF3 pAb (ATL-HPA036332) Datasheet (External Link) |
Vendor Page | Anti ABCF3 pAb (ATL-HPA036332) |
Citations for Anti ABCF3 pAb (ATL-HPA036332) – 1 Found |
Pennemann, Friederike L; Mussabekova, Assel; Urban, Christian; Stukalov, Alexey; Andersen, Line Lykke; Grass, Vincent; Lavacca, Teresa Maria; Holze, Cathleen; Oubraham, Lila; Benamrouche, Yasmine; Girardi, Enrico; Boulos, Rasha E; Hartmann, Rune; Superti-Furga, Giulio; Habjan, Matthias; Imler, Jean-Luc; Meignin, Carine; Pichlmair, Andreas. Cross-species analysis of viral nucleic acid interacting proteins identifies TAOKs as innate immune regulators. Nature Communications. 2021;12(1):7009. PubMed |