Anti ABCF3 pAb (ATL-HPA036332)

Atlas Antibodies

Catalog No.:
ATL-HPA036332-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family F (GCN20), member 3
Gene Name: ABCF3
Alternative Gene Name: EST201864
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003234: 96%, ENSRNOG00000001710: 95%
Entrez Gene ID: 55324
Uniprot ID: Q9NUQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FESVDDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLLDAPIQLSKITENYDCGTKLPGLL
Gene Sequence FESVDDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLLDAPIQLSKITENYDCGTKLPGLL
Gene ID - Mouse ENSMUSG00000003234
Gene ID - Rat ENSRNOG00000001710
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABCF3 pAb (ATL-HPA036332)
Datasheet Anti ABCF3 pAb (ATL-HPA036332) Datasheet (External Link)
Vendor Page Anti ABCF3 pAb (ATL-HPA036332) at Atlas Antibodies

Documents & Links for Anti ABCF3 pAb (ATL-HPA036332)
Datasheet Anti ABCF3 pAb (ATL-HPA036332) Datasheet (External Link)
Vendor Page Anti ABCF3 pAb (ATL-HPA036332)
Citations for Anti ABCF3 pAb (ATL-HPA036332) – 1 Found
Pennemann, Friederike L; Mussabekova, Assel; Urban, Christian; Stukalov, Alexey; Andersen, Line Lykke; Grass, Vincent; Lavacca, Teresa Maria; Holze, Cathleen; Oubraham, Lila; Benamrouche, Yasmine; Girardi, Enrico; Boulos, Rasha E; Hartmann, Rune; Superti-Furga, Giulio; Habjan, Matthias; Imler, Jean-Luc; Meignin, Carine; Pichlmair, Andreas. Cross-species analysis of viral nucleic acid interacting proteins identifies TAOKs as innate immune regulators. Nature Communications. 2021;12(1):7009.  PubMed