Anti ABCF2 pAb (ATL-HPA021815)

Atlas Antibodies

Catalog No.:
ATL-HPA021815-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family F (GCN20), member 2
Gene Name: ABCF2
Alternative Gene Name: ABC28, EST133090, HUSSY-18, M-ABC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028953: 88%, ENSRNOG00000010609: 88%
Entrez Gene ID: 10061
Uniprot ID: Q9UG63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNVCTLTLASLPRP
Gene Sequence NHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNVCTLTLASLPRP
Gene ID - Mouse ENSMUSG00000028953
Gene ID - Rat ENSRNOG00000010609
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABCF2 pAb (ATL-HPA021815)
Datasheet Anti ABCF2 pAb (ATL-HPA021815) Datasheet (External Link)
Vendor Page Anti ABCF2 pAb (ATL-HPA021815) at Atlas Antibodies

Documents & Links for Anti ABCF2 pAb (ATL-HPA021815)
Datasheet Anti ABCF2 pAb (ATL-HPA021815) Datasheet (External Link)
Vendor Page Anti ABCF2 pAb (ATL-HPA021815)