Anti ABCF1 pAb (ATL-HPA017578 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA017578-25

• 
• 
• 

Protein Description: ATP-binding cassette, sub-family F (GCN20), member 1
Gene Name: ABCF1
Alternative Gene Name: ABC50, EST123147
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038762: 73%, ENSRNOG00000000799: 72%
Entrez Gene ID: 23
Uniprot ID: Q8NE71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPKPRGGKKTKGGNVFAALIQDQSEEEEEEEKHPPKPAKPEKNRINKAVSEEQQPALKGKKGKEEKSKGKAKPQNKFAAL
• Gene Sequence: KKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPKPRGGKKTKGGNVFAALIQDQSEEEEEEEKHPPKPAKPEKNRINKAVSEEQQPALKGKKGKEEKSKGKAKPQNKFAAL
• Gene ID - Mouse: ENSMUSG00000038762
• Gene ID - Rat: ENSRNOG00000000799
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ABCF1 pAb (ATL-HPA017578 w/enhanced validation) – 1 Found

Cao, Quynh T; Aguiar, Jennifer A; Tremblay, Benjamin J-M; Abbas, Nadin; Tiessen, Nicholas; Revill, Spencer; Makhdami, Nima; Ayoub, Anmar; Cox, Gerard; Ask, Kjetil; Doxey, Andrew C; Hirota, Jeremy A. ABCF1 Regulates dsDNA-induced Immune Responses in Human Airway Epithelial Cells. Frontiers In Cellular And Infection Microbiology. 10( 33042865):487.