Anti ABCF1 pAb (ATL-HPA017578 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017578-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ABCF1
Alternative Gene Name: ABC50, EST123147
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038762: 73%, ENSRNOG00000000799: 72%
Entrez Gene ID: 23
Uniprot ID: Q8NE71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPKPRGGKKTKGGNVFAALIQDQSEEEEEEEKHPPKPAKPEKNRINKAVSEEQQPALKGKKGKEEKSKGKAKPQNKFAAL |
Gene Sequence | KKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPKPRGGKKTKGGNVFAALIQDQSEEEEEEEKHPPKPAKPEKNRINKAVSEEQQPALKGKKGKEEKSKGKAKPQNKFAAL |
Gene ID - Mouse | ENSMUSG00000038762 |
Gene ID - Rat | ENSRNOG00000000799 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABCF1 pAb (ATL-HPA017578 w/enhanced validation) | |
Datasheet | Anti ABCF1 pAb (ATL-HPA017578 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ABCF1 pAb (ATL-HPA017578 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ABCF1 pAb (ATL-HPA017578 w/enhanced validation) | |
Datasheet | Anti ABCF1 pAb (ATL-HPA017578 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ABCF1 pAb (ATL-HPA017578 w/enhanced validation) |
Citations for Anti ABCF1 pAb (ATL-HPA017578 w/enhanced validation) – 1 Found |
Cao, Quynh T; Aguiar, Jennifer A; Tremblay, Benjamin J-M; Abbas, Nadin; Tiessen, Nicholas; Revill, Spencer; Makhdami, Nima; Ayoub, Anmar; Cox, Gerard; Ask, Kjetil; Doxey, Andrew C; Hirota, Jeremy A. ABCF1 Regulates dsDNA-induced Immune Responses in Human Airway Epithelial Cells. Frontiers In Cellular And Infection Microbiology. 10( 33042865):487. PubMed |