Anti ABCE1 pAb (ATL-HPA036846)

Atlas Antibodies

SKU:
ATL-HPA036846-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family E (OABP), member 1
Gene Name: ABCE1
Alternative Gene Name: OABP, RLI, RNASEL1, RNASELI, RNS4I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058355: 100%, ENSRNOG00000018345: 99%
Entrez Gene ID: 6059
Uniprot ID: P61221
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINP
Gene Sequence KAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINP
Gene ID - Mouse ENSMUSG00000058355
Gene ID - Rat ENSRNOG00000018345
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ABCE1 pAb (ATL-HPA036846)
Datasheet Anti ABCE1 pAb (ATL-HPA036846) Datasheet (External Link)
Vendor Page Anti ABCE1 pAb (ATL-HPA036846) at Atlas Antibodies

Documents & Links for Anti ABCE1 pAb (ATL-HPA036846)
Datasheet Anti ABCE1 pAb (ATL-HPA036846) Datasheet (External Link)
Vendor Page Anti ABCE1 pAb (ATL-HPA036846)