Anti ABCD3 pAb (ATL-HPA032027 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA032027-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ABCD3
Alternative Gene Name: PMP70, PXMP1, ZWS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028127: 96%, ENSRNOG00000011929: 96%
Entrez Gene ID: 5825
Uniprot ID: P28288
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS |
| Gene Sequence | VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS |
| Gene ID - Mouse | ENSMUSG00000028127 |
| Gene ID - Rat | ENSRNOG00000011929 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABCD3 pAb (ATL-HPA032027 w/enhanced validation) | |
| Datasheet | Anti ABCD3 pAb (ATL-HPA032027 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ABCD3 pAb (ATL-HPA032027 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ABCD3 pAb (ATL-HPA032027 w/enhanced validation) | |
| Datasheet | Anti ABCD3 pAb (ATL-HPA032027 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ABCD3 pAb (ATL-HPA032027 w/enhanced validation) |
| Citations for Anti ABCD3 pAb (ATL-HPA032027 w/enhanced validation) – 3 Found |
| Reams, R Renee; Jones-Triche, Jacqueline; Chan, Owen T M; Hernandez, Brenda Y; Soliman, Karam F A; Yates, Clayton. Immunohistological analysis of ABCD3 expression in Caucasian and African American prostate tumors. Biomed Research International. 2015( 25802834):132981. PubMed |
| Assadi, Ghazaleh; Vesterlund, Liselotte; Bonfiglio, Ferdinando; Mazzurana, Luca; Cordeddu, Lina; Schepis, Danika; Mjösberg, Jenny; Ruhrmann, Sabrina; Fabbri, Alessia; Vukojevic, Vladana; Percipalle, Piergiorgio; Salomons, Florian A; Laurencikiene, Jurga; Törkvist, Leif; Halfvarson, Jonas; D'Amato, Mauro. Functional Analyses of the Crohn's Disease Risk Gene LACC1. Plos One. 11(12):e0168276. PubMed |
| Zhang, Yujiao; Zhang, Yaqi; Wang, Jiping; Yang, Jiyuan; Yang, Guodong. Abnormal expression of ABCD3 is an independent prognostic factor for colorectal cancer. Oncology Letters. 2020;19(5):3567-3577. PubMed |