Anti ABCD3 pAb (ATL-HPA032026 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA032026-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ABCD3
Alternative Gene Name: PMP70, PXMP1, ZWS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028127: 86%, ENSRNOG00000011929: 88%
Entrez Gene ID: 5825
Uniprot ID: P28288
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGP |
Gene Sequence | MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGP |
Gene ID - Mouse | ENSMUSG00000028127 |
Gene ID - Rat | ENSRNOG00000011929 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABCD3 pAb (ATL-HPA032026 w/enhanced validation) | |
Datasheet | Anti ABCD3 pAb (ATL-HPA032026 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ABCD3 pAb (ATL-HPA032026 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ABCD3 pAb (ATL-HPA032026 w/enhanced validation) | |
Datasheet | Anti ABCD3 pAb (ATL-HPA032026 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ABCD3 pAb (ATL-HPA032026 w/enhanced validation) |
Citations for Anti ABCD3 pAb (ATL-HPA032026 w/enhanced validation) – 1 Found |
Zhang, Yujiao; Zhang, Yaqi; Wang, Jiping; Yang, Jiyuan; Yang, Guodong. Abnormal expression of ABCD3 is an independent prognostic factor for colorectal cancer. Oncology Letters. 2020;19(5):3567-3577. PubMed |