Anti ABCC10 pAb (ATL-HPA041607)

Atlas Antibodies

Catalog No.:
ATL-HPA041607-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family C (CFTR/MRP), member 10
Gene Name: ABCC10
Alternative Gene Name: EST182763, MRP7, SIMRP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032842: 76%, ENSRNOG00000018863: 78%
Entrez Gene ID: 89845
Uniprot ID: Q5T3U5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLPNALDGVTFCVQPGEKLGIVG
Gene Sequence RLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLPNALDGVTFCVQPGEKLGIVG
Gene ID - Mouse ENSMUSG00000032842
Gene ID - Rat ENSRNOG00000018863
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABCC10 pAb (ATL-HPA041607)
Datasheet Anti ABCC10 pAb (ATL-HPA041607) Datasheet (External Link)
Vendor Page Anti ABCC10 pAb (ATL-HPA041607) at Atlas Antibodies

Documents & Links for Anti ABCC10 pAb (ATL-HPA041607)
Datasheet Anti ABCC10 pAb (ATL-HPA041607) Datasheet (External Link)
Vendor Page Anti ABCC10 pAb (ATL-HPA041607)
Citations for Anti ABCC10 pAb (ATL-HPA041607) – 1 Found
Wang, Jing-Quan; Wu, Zhuo-Xun; Yang, Yuqi; Li, Jin-Sui; Yang, Dong-Hua; Fan, Ying-Fang; Chen, Zhe-Sheng. Establishment and Characterization of a Novel Multidrug Resistant Human Ovarian Cancer Cell Line With Heterogenous MRP7 Overexpression. Frontiers In Oncology. 11( 34631561):731260.  PubMed