Anti ABCC10 pAb (ATL-HPA041607)

Atlas Antibodies

SKU: ATL-HPA041607-25

• 

Protein Description: ATP-binding cassette, sub-family C (CFTR/MRP), member 10
Gene Name: ABCC10
Alternative Gene Name: EST182763, MRP7, SIMRP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032842: 76%, ENSRNOG00000018863: 78%
Entrez Gene ID: 89845
Uniprot ID: Q5T3U5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLPNALDGVTFCVQPGEKLGIVG
• Gene Sequence: RLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLPNALDGVTFCVQPGEKLGIVG
• Gene ID - Mouse: ENSMUSG00000032842
• Gene ID - Rat: ENSRNOG00000018863
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ABCC10 pAb (ATL-HPA041607) – 1 Found

Wang, Jing-Quan; Wu, Zhuo-Xun; Yang, Yuqi; Li, Jin-Sui; Yang, Dong-Hua; Fan, Ying-Fang; Chen, Zhe-Sheng. Establishment and Characterization of a Novel Multidrug Resistant Human Ovarian Cancer Cell Line With Heterogenous MRP7 Overexpression. Frontiers In Oncology. 11( 34631561):731260.