Anti ABCC1 pAb (ATL-HPA076011)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076011-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ABCC1
Alternative Gene Name: GS-X, MRP, MRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023088: 75%, ENSRNOG00000022305: 73%
Entrez Gene ID: 4363
Uniprot ID: P33527
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVL |
| Gene Sequence | GLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVL |
| Gene ID - Mouse | ENSMUSG00000023088 |
| Gene ID - Rat | ENSRNOG00000022305 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABCC1 pAb (ATL-HPA076011) | |
| Datasheet | Anti ABCC1 pAb (ATL-HPA076011) Datasheet (External Link) |
| Vendor Page | Anti ABCC1 pAb (ATL-HPA076011) at Atlas Antibodies |
| Documents & Links for Anti ABCC1 pAb (ATL-HPA076011) | |
| Datasheet | Anti ABCC1 pAb (ATL-HPA076011) Datasheet (External Link) |
| Vendor Page | Anti ABCC1 pAb (ATL-HPA076011) |