Anti ABCC1 pAb (ATL-HPA002380)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002380-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ABCC1
Alternative Gene Name: GS-X, MRP, MRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023088: 76%, ENSRNOG00000022305: 73%
Entrez Gene ID: 4363
Uniprot ID: P33527
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD |
Gene Sequence | LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD |
Gene ID - Mouse | ENSMUSG00000023088 |
Gene ID - Rat | ENSRNOG00000022305 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABCC1 pAb (ATL-HPA002380) | |
Datasheet | Anti ABCC1 pAb (ATL-HPA002380) Datasheet (External Link) |
Vendor Page | Anti ABCC1 pAb (ATL-HPA002380) at Atlas Antibodies |
Documents & Links for Anti ABCC1 pAb (ATL-HPA002380) | |
Datasheet | Anti ABCC1 pAb (ATL-HPA002380) Datasheet (External Link) |
Vendor Page | Anti ABCC1 pAb (ATL-HPA002380) |
Citations for Anti ABCC1 pAb (ATL-HPA002380) – 3 Found |
Bernstein, Hans-Gert; Hölzl, Gloria; Dobrowolny, Henrik; Hildebrandt, Jens; Trübner, Kurt; Krohn, Markus; Bogerts, Bernhard; Pahnke, Jens. Vascular and extravascular distribution of the ATP-binding cassette transporters ABCB1 and ABCC1 in aged human brain and pituitary. Mechanisms Of Ageing And Development. 2014;141-142( 25218792):12-21. PubMed |
Veringa, Susanna J E; Biesmans, Dennis; van Vuurden, Dannis G; Jansen, Marc H A; Wedekind, Laurine E; Horsman, Ilona; Wesseling, Pieter; Vandertop, William Peter; Noske, David P; Kaspers, GertJan J L; Hulleman, Esther. In vitro drug response and efflux transporters associated with drug resistance in pediatric high grade glioma and diffuse intrinsic pontine glioma. Plos One. 8(4):e61512. PubMed |
Silva, Virgílio Souza E; Abdallah, Emne Ali; Brito, Angelo Borsarelli Carvalho de; Braun, Alexcia Camila; Tariki, Milena Shizue; de Mello, Celso Abdon Lopes; Calsavara, Vinicius Fernando; Riechelmann, Rachel; Chinen, Ludmilla Thomé Domingos. Baseline and Kinetic Circulating Tumor Cell Counts Are Prognostic Factors in a Prospective Study of Metastatic Colorectal Cancer. Diagnostics (Basel, Switzerland). 2021;11(3) PubMed |