Anti ABCC1 pAb (ATL-HPA002380)

Atlas Antibodies

Catalog No.: ATL-HPA002380-25

Protein Description: ATP-binding cassette, sub-family C (CFTR/MRP), member 1
Gene Name: ABCC1
Alternative Gene Name: GS-X, MRP, MRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023088: 76%, ENSRNOG00000022305: 73%
Entrez Gene ID: 4363
Uniprot ID: P33527
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD
• Gene Sequence: LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD
• Gene ID - Mouse: ENSMUSG00000023088
• Gene ID - Rat: ENSRNOG00000022305
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ABCC1 pAb (ATL-HPA002380) – 3 Found

Bernstein, Hans-Gert; Hölzl, Gloria; Dobrowolny, Henrik; Hildebrandt, Jens; Trübner, Kurt; Krohn, Markus; Bogerts, Bernhard; Pahnke, Jens. Vascular and extravascular distribution of the ATP-binding cassette transporters ABCB1 and ABCC1 in aged human brain and pituitary. Mechanisms Of Ageing And Development. 2014;141-142( 25218792):12-21. 

Veringa, Susanna J E; Biesmans, Dennis; van Vuurden, Dannis G; Jansen, Marc H A; Wedekind, Laurine E; Horsman, Ilona; Wesseling, Pieter; Vandertop, William Peter; Noske, David P; Kaspers, GertJan J L; Hulleman, Esther. In vitro drug response and efflux transporters associated with drug resistance in pediatric high grade glioma and diffuse intrinsic pontine glioma. Plos One. 8(4):e61512. 

Silva, Virgílio Souza E; Abdallah, Emne Ali; Brito, Angelo Borsarelli Carvalho de; Braun, Alexcia Camila; Tariki, Milena Shizue; de Mello, Celso Abdon Lopes; Calsavara, Vinicius Fernando; Riechelmann, Rachel; Chinen, Ludmilla Thomé Domingos. Baseline and Kinetic Circulating Tumor Cell Counts Are Prognostic Factors in a Prospective Study of Metastatic Colorectal Cancer. Diagnostics (Basel, Switzerland). 2021;11(3)