Anti ABCB9 pAb (ATL-HPA035114)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035114-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ABCB9
Alternative Gene Name: EST122234
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029408: 100%, ENSRNOG00000001082: 99%
Entrez Gene ID: 23457
Uniprot ID: Q9NP78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLS |
Gene Sequence | ESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLS |
Gene ID - Mouse | ENSMUSG00000029408 |
Gene ID - Rat | ENSRNOG00000001082 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABCB9 pAb (ATL-HPA035114) | |
Datasheet | Anti ABCB9 pAb (ATL-HPA035114) Datasheet (External Link) |
Vendor Page | Anti ABCB9 pAb (ATL-HPA035114) at Atlas Antibodies |
Documents & Links for Anti ABCB9 pAb (ATL-HPA035114) | |
Datasheet | Anti ABCB9 pAb (ATL-HPA035114) Datasheet (External Link) |
Vendor Page | Anti ABCB9 pAb (ATL-HPA035114) |