Anti ABCB9 pAb (ATL-HPA035114)

Atlas Antibodies

Catalog No.: ATL-HPA035114-25

Protein Description: ATP-binding cassette, sub-family B (MDR/TAP), member 9
Gene Name: ABCB9
Alternative Gene Name: EST122234
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029408: 100%, ENSRNOG00000001082: 99%
Entrez Gene ID: 23457
Uniprot ID: Q9NP78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLS
• Gene Sequence: ESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLS
• Gene ID - Mouse: ENSMUSG00000029408
• Gene ID - Rat: ENSRNOG00000001082
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.