Anti ABCB9 pAb (ATL-HPA035113)

Atlas Antibodies

Catalog No.:
ATL-HPA035113-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family B (MDR/TAP), member 9
Gene Name: ABCB9
Alternative Gene Name: EST122234
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029408: 69%, ENSRNOG00000001082: 72%
Entrez Gene ID: 23457
Uniprot ID: Q9NP78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGLYAKLVQRQMLGLQPAADFTAGHNEPVANGSHKA
Gene Sequence GGLYAKLVQRQMLGLQPAADFTAGHNEPVANGSHKA
Gene ID - Mouse ENSMUSG00000029408
Gene ID - Rat ENSRNOG00000001082
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABCB9 pAb (ATL-HPA035113)
Datasheet Anti ABCB9 pAb (ATL-HPA035113) Datasheet (External Link)
Vendor Page Anti ABCB9 pAb (ATL-HPA035113) at Atlas Antibodies

Documents & Links for Anti ABCB9 pAb (ATL-HPA035113)
Datasheet Anti ABCB9 pAb (ATL-HPA035113) Datasheet (External Link)
Vendor Page Anti ABCB9 pAb (ATL-HPA035113)