Anti ABCB8 pAb (ATL-HPA045187)

Atlas Antibodies

Catalog No.:
ATL-HPA045187-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family B (MDR/TAP), member 8
Gene Name: ABCB8
Alternative Gene Name: EST328128, M-ABC1, MABC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028973: 68%, ENSRNOG00000008557: 65%
Entrez Gene ID: 11194
Uniprot ID: Q9NUT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFRVGIRGGPFPGRLLPPLRFQTFSAVRYSDGYRSSSLLRAVAHLRSQLWAHLPRAPLAPRWSPSAWCWVGGALLGPMVLSKHPHLCLVALCEAEEAPPASSTPHVVGSRFNWKLFWQFL
Gene Sequence LFRVGIRGGPFPGRLLPPLRFQTFSAVRYSDGYRSSSLLRAVAHLRSQLWAHLPRAPLAPRWSPSAWCWVGGALLGPMVLSKHPHLCLVALCEAEEAPPASSTPHVVGSRFNWKLFWQFL
Gene ID - Mouse ENSMUSG00000028973
Gene ID - Rat ENSRNOG00000008557
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABCB8 pAb (ATL-HPA045187)
Datasheet Anti ABCB8 pAb (ATL-HPA045187) Datasheet (External Link)
Vendor Page Anti ABCB8 pAb (ATL-HPA045187) at Atlas Antibodies

Documents & Links for Anti ABCB8 pAb (ATL-HPA045187)
Datasheet Anti ABCB8 pAb (ATL-HPA045187) Datasheet (External Link)
Vendor Page Anti ABCB8 pAb (ATL-HPA045187)