Anti ABCB8 pAb (ATL-HPA045187)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045187-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ABCB8
Alternative Gene Name: EST328128, M-ABC1, MABC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028973: 68%, ENSRNOG00000008557: 65%
Entrez Gene ID: 11194
Uniprot ID: Q9NUT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LFRVGIRGGPFPGRLLPPLRFQTFSAVRYSDGYRSSSLLRAVAHLRSQLWAHLPRAPLAPRWSPSAWCWVGGALLGPMVLSKHPHLCLVALCEAEEAPPASSTPHVVGSRFNWKLFWQFL |
| Gene Sequence | LFRVGIRGGPFPGRLLPPLRFQTFSAVRYSDGYRSSSLLRAVAHLRSQLWAHLPRAPLAPRWSPSAWCWVGGALLGPMVLSKHPHLCLVALCEAEEAPPASSTPHVVGSRFNWKLFWQFL |
| Gene ID - Mouse | ENSMUSG00000028973 |
| Gene ID - Rat | ENSRNOG00000008557 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABCB8 pAb (ATL-HPA045187) | |
| Datasheet | Anti ABCB8 pAb (ATL-HPA045187) Datasheet (External Link) |
| Vendor Page | Anti ABCB8 pAb (ATL-HPA045187) at Atlas Antibodies |
| Documents & Links for Anti ABCB8 pAb (ATL-HPA045187) | |
| Datasheet | Anti ABCB8 pAb (ATL-HPA045187) Datasheet (External Link) |
| Vendor Page | Anti ABCB8 pAb (ATL-HPA045187) |