Anti ABCB7 pAb (ATL-HPA034982)

Atlas Antibodies

Catalog No.: ATL-HPA034982-25

Protein Description: ATP-binding cassette, sub-family B (MDR/TAP), member 7
Gene Name: ABCB7
Alternative Gene Name: ABC7, ASAT, Atm1p, EST140535
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031333: 86%, ENSRNOG00000002790: 87%
Entrez Gene ID: 22
Uniprot ID: O75027
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI
• Gene Sequence: GAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI
• Gene ID - Mouse: ENSMUSG00000031333
• Gene ID - Rat: ENSRNOG00000002790
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.