Anti ABCB7 pAb (ATL-HPA034982)

Atlas Antibodies

Catalog No.:
ATL-HPA034982-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family B (MDR/TAP), member 7
Gene Name: ABCB7
Alternative Gene Name: ABC7, ASAT, Atm1p, EST140535
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031333: 86%, ENSRNOG00000002790: 87%
Entrez Gene ID: 22
Uniprot ID: O75027
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI
Gene Sequence GAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI
Gene ID - Mouse ENSMUSG00000031333
Gene ID - Rat ENSRNOG00000002790
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABCB7 pAb (ATL-HPA034982)
Datasheet Anti ABCB7 pAb (ATL-HPA034982) Datasheet (External Link)
Vendor Page Anti ABCB7 pAb (ATL-HPA034982) at Atlas Antibodies

Documents & Links for Anti ABCB7 pAb (ATL-HPA034982)
Datasheet Anti ABCB7 pAb (ATL-HPA034982) Datasheet (External Link)
Vendor Page Anti ABCB7 pAb (ATL-HPA034982)