Anti ABCB4 pAb (ATL-HPA053288)
Atlas Antibodies
- SKU:
- ATL-HPA053288-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ABCB4
Alternative Gene Name: GBD1, MDR2, MDR3 , PFIC-3, PGY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042476: 67%, ENSRNOG00000008012: 67%
Entrez Gene ID: 5244
Uniprot ID: P21439
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQD |
Gene Sequence | LEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQD |
Gene ID - Mouse | ENSMUSG00000042476 |
Gene ID - Rat | ENSRNOG00000008012 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABCB4 pAb (ATL-HPA053288) | |
Datasheet | Anti ABCB4 pAb (ATL-HPA053288) Datasheet (External Link) |
Vendor Page | Anti ABCB4 pAb (ATL-HPA053288) at Atlas Antibodies |
Documents & Links for Anti ABCB4 pAb (ATL-HPA053288) | |
Datasheet | Anti ABCB4 pAb (ATL-HPA053288) Datasheet (External Link) |
Vendor Page | Anti ABCB4 pAb (ATL-HPA053288) |
Citations for Anti ABCB4 pAb (ATL-HPA053288) – 2 Found |
Hontecillas-Prieto, Lourdes; Garcia-Dominguez, Daniel J; Vaca, Diego Pascual; Garcia-Mejias, Rosa; Marcilla, David; Ramirez-Villar, Gema L; Saez, Carmen; de Álava, Enrique. Multidrug resistance transporter profile reveals MDR3 as a marker for stratification of blastemal Wilms tumour patients. Oncotarget. 2017;8(7):11173-11186. PubMed |
Hontecillas-Prieto, Lourdes; García-Domínguez, Daniel J; García-Mejías, Rosa; Ramírez-Villar, Gema L; Sáez, Carmen; de Álava, Enrique. HMGA2 overexpression predicts relapse susceptibility of blastemal Wilms tumor patients. Oncotarget. 2017;8(70):115290-115303. PubMed |