Anti ABCB4 pAb (ATL-HPA053288)

Atlas Antibodies

SKU:
ATL-HPA053288-25
  • Immunohistochemical staining of human liver shows weak to moderate membranous positivity in bile duct cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family B (MDR/TAP), member 4
Gene Name: ABCB4
Alternative Gene Name: GBD1, MDR2, MDR3 , PFIC-3, PGY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042476: 67%, ENSRNOG00000008012: 67%
Entrez Gene ID: 5244
Uniprot ID: P21439
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQD
Gene Sequence LEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQD
Gene ID - Mouse ENSMUSG00000042476
Gene ID - Rat ENSRNOG00000008012
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ABCB4 pAb (ATL-HPA053288)
Datasheet Anti ABCB4 pAb (ATL-HPA053288) Datasheet (External Link)
Vendor Page Anti ABCB4 pAb (ATL-HPA053288) at Atlas Antibodies

Documents & Links for Anti ABCB4 pAb (ATL-HPA053288)
Datasheet Anti ABCB4 pAb (ATL-HPA053288) Datasheet (External Link)
Vendor Page Anti ABCB4 pAb (ATL-HPA053288)



Citations for Anti ABCB4 pAb (ATL-HPA053288) – 2 Found
Hontecillas-Prieto, Lourdes; Garcia-Dominguez, Daniel J; Vaca, Diego Pascual; Garcia-Mejias, Rosa; Marcilla, David; Ramirez-Villar, Gema L; Saez, Carmen; de Álava, Enrique. Multidrug resistance transporter profile reveals MDR3 as a marker for stratification of blastemal Wilms tumour patients. Oncotarget. 2017;8(7):11173-11186.  PubMed
Hontecillas-Prieto, Lourdes; García-Domínguez, Daniel J; García-Mejías, Rosa; Ramírez-Villar, Gema L; Sáez, Carmen; de Álava, Enrique. HMGA2 overexpression predicts relapse susceptibility of blastemal Wilms tumor patients. Oncotarget. 2017;8(70):115290-115303.  PubMed