Anti ABCB10 pAb (ATL-HPA055175)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055175-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ABCB10
Alternative Gene Name: EST20237, M-ABC2, MTABC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031974: 96%, ENSRNOG00000017993: 94%
Entrez Gene ID: 23456
Uniprot ID: Q9NRK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTE |
| Gene Sequence | MQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTE |
| Gene ID - Mouse | ENSMUSG00000031974 |
| Gene ID - Rat | ENSRNOG00000017993 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABCB10 pAb (ATL-HPA055175) | |
| Datasheet | Anti ABCB10 pAb (ATL-HPA055175) Datasheet (External Link) |
| Vendor Page | Anti ABCB10 pAb (ATL-HPA055175) at Atlas Antibodies |
| Documents & Links for Anti ABCB10 pAb (ATL-HPA055175) | |
| Datasheet | Anti ABCB10 pAb (ATL-HPA055175) Datasheet (External Link) |
| Vendor Page | Anti ABCB10 pAb (ATL-HPA055175) |