Anti ABCA9 pAb (ATL-HPA052113)

Atlas Antibodies

Catalog No.:
ATL-HPA052113-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ATP binding cassette subfamily A member 9
Gene Name: ABCA9
Alternative Gene Name: EST640918
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041797: 84%, ENSRNOG00000059326: 79%
Entrez Gene ID: 10350
Uniprot ID: Q8IUA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEYGYR
Gene Sequence NCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEYGYR
Gene ID - Mouse ENSMUSG00000041797
Gene ID - Rat ENSRNOG00000059326
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABCA9 pAb (ATL-HPA052113)
Datasheet Anti ABCA9 pAb (ATL-HPA052113) Datasheet (External Link)
Vendor Page Anti ABCA9 pAb (ATL-HPA052113) at Atlas Antibodies

Documents & Links for Anti ABCA9 pAb (ATL-HPA052113)
Datasheet Anti ABCA9 pAb (ATL-HPA052113) Datasheet (External Link)
Vendor Page Anti ABCA9 pAb (ATL-HPA052113)