Anti ABCA9 pAb (ATL-HPA052113)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052113-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ABCA9
Alternative Gene Name: EST640918
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041797: 84%, ENSRNOG00000059326: 79%
Entrez Gene ID: 10350
Uniprot ID: Q8IUA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEYGYR |
Gene Sequence | NCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEYGYR |
Gene ID - Mouse | ENSMUSG00000041797 |
Gene ID - Rat | ENSRNOG00000059326 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABCA9 pAb (ATL-HPA052113) | |
Datasheet | Anti ABCA9 pAb (ATL-HPA052113) Datasheet (External Link) |
Vendor Page | Anti ABCA9 pAb (ATL-HPA052113) at Atlas Antibodies |
Documents & Links for Anti ABCA9 pAb (ATL-HPA052113) | |
Datasheet | Anti ABCA9 pAb (ATL-HPA052113) Datasheet (External Link) |
Vendor Page | Anti ABCA9 pAb (ATL-HPA052113) |