Anti ABCA7 pAb (ATL-HPA041564 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041564-25
  • Immunohistochemistry analysis in human bone marrow and skeletal muscle tissues using HPA041564 antibody. Corresponding ABCA7 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, the Golgi apparatus & cell junctions.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family A (ABC1), member 7
Gene Name: ABCA7
Alternative Gene Name: ABCX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035722: 62%, ENSRNOG00000012939: 60%
Entrez Gene ID: 10347
Uniprot ID: Q8IZY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHL
Gene Sequence VNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHL
Gene ID - Mouse ENSMUSG00000035722
Gene ID - Rat ENSRNOG00000012939
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ABCA7 pAb (ATL-HPA041564 w/enhanced validation)
Datasheet Anti ABCA7 pAb (ATL-HPA041564 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABCA7 pAb (ATL-HPA041564 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ABCA7 pAb (ATL-HPA041564 w/enhanced validation)
Datasheet Anti ABCA7 pAb (ATL-HPA041564 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABCA7 pAb (ATL-HPA041564 w/enhanced validation)