Anti ABCA7 pAb (ATL-HPA041564 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041564-25

Protein Description: ATP-binding cassette, sub-family A (ABC1), member 7
Gene Name: ABCA7
Alternative Gene Name: ABCX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035722: 62%, ENSRNOG00000012939: 60%
Entrez Gene ID: 10347
Uniprot ID: Q8IZY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHL
• Gene Sequence: VNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHL
• Gene ID - Mouse: ENSMUSG00000035722
• Gene ID - Rat: ENSRNOG00000012939
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.