Anti ABCA5 pAb (ATL-HPA062904)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062904-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ABCA5
Alternative Gene Name: EST90625
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018800: 96%, ENSRNOG00000004378: 96%
Entrez Gene ID: 23461
Uniprot ID: Q8WWZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DQQLVYSLPFKDMDKFSGLFSALDSHSNLGVISYGVSMTTLEDVFLKLEVEAEIDQADYSVFTQQPLEEEMDSKSFDEMEQSLLILSETKASLVSTMS |
| Gene Sequence | DQQLVYSLPFKDMDKFSGLFSALDSHSNLGVISYGVSMTTLEDVFLKLEVEAEIDQADYSVFTQQPLEEEMDSKSFDEMEQSLLILSETKASLVSTMS |
| Gene ID - Mouse | ENSMUSG00000018800 |
| Gene ID - Rat | ENSRNOG00000004378 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABCA5 pAb (ATL-HPA062904) | |
| Datasheet | Anti ABCA5 pAb (ATL-HPA062904) Datasheet (External Link) |
| Vendor Page | Anti ABCA5 pAb (ATL-HPA062904) at Atlas Antibodies |
| Documents & Links for Anti ABCA5 pAb (ATL-HPA062904) | |
| Datasheet | Anti ABCA5 pAb (ATL-HPA062904) Datasheet (External Link) |
| Vendor Page | Anti ABCA5 pAb (ATL-HPA062904) |