Anti ABCA5 pAb (ATL-HPA022032)

Atlas Antibodies

SKU: ATL-HPA022032-25

• 

Protein Description: ATP-binding cassette, sub-family A (ABC1), member 5
Gene Name: ABCA5
Alternative Gene Name: EST90625
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018800: 81%, ENSRNOG00000004378: 81%
Entrez Gene ID: 23461
Uniprot ID: Q8WWZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PNKKYEEVPNIELNPMDKFTLSNLILGYTPVTNITSSIMQKVSTDHLPDVIITEEYTNEKEMLTSSLSKPSNFV
• Gene Sequence: PNKKYEEVPNIELNPMDKFTLSNLILGYTPVTNITSSIMQKVSTDHLPDVIITEEYTNEKEMLTSSLSKPSNFV
• Gene ID - Mouse: ENSMUSG00000018800
• Gene ID - Rat: ENSRNOG00000004378
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.