Anti ABCA4 pAb (ATL-HPA078826)

Atlas Antibodies

SKU:
ATL-HPA078826-25
  • Immunohistochemical staining of human retina shows strong cytoplasmic positivity in photoreceptor cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ATP binding cassette subfamily A member 4
Gene Name: ABCA4
Alternative Gene Name: ABCR, ARMD2, CORD3, FFM, RP19, STGD, STGD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028125: 84%, ENSRNOG00000012892: 83%
Entrez Gene ID: 24
Uniprot ID: P78363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEET
Gene Sequence IQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEET
Gene ID - Mouse ENSMUSG00000028125
Gene ID - Rat ENSRNOG00000012892
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ABCA4 pAb (ATL-HPA078826)
Datasheet Anti ABCA4 pAb (ATL-HPA078826) Datasheet (External Link)
Vendor Page Anti ABCA4 pAb (ATL-HPA078826) at Atlas Antibodies

Documents & Links for Anti ABCA4 pAb (ATL-HPA078826)
Datasheet Anti ABCA4 pAb (ATL-HPA078826) Datasheet (External Link)
Vendor Page Anti ABCA4 pAb (ATL-HPA078826)