Anti ABCA2 pAb (ATL-HPA042886)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042886-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ABCA2
Alternative Gene Name: ABC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026944: 91%, ENSRNOG00000014268: 89%
Entrez Gene ID: 20
Uniprot ID: Q9BZC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTISVKEAFYTAAPLTSAGILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPSLGSELEALRQHLEALSAGPGTSGSHLDRSTVSSFSLDSV |
| Gene Sequence | PTISVKEAFYTAAPLTSAGILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPSLGSELEALRQHLEALSAGPGTSGSHLDRSTVSSFSLDSV |
| Gene ID - Mouse | ENSMUSG00000026944 |
| Gene ID - Rat | ENSRNOG00000014268 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABCA2 pAb (ATL-HPA042886) | |
| Datasheet | Anti ABCA2 pAb (ATL-HPA042886) Datasheet (External Link) |
| Vendor Page | Anti ABCA2 pAb (ATL-HPA042886) at Atlas Antibodies |
| Documents & Links for Anti ABCA2 pAb (ATL-HPA042886) | |
| Datasheet | Anti ABCA2 pAb (ATL-HPA042886) Datasheet (External Link) |
| Vendor Page | Anti ABCA2 pAb (ATL-HPA042886) |