Anti ABCA2 pAb (ATL-HPA042886)

Atlas Antibodies

SKU:
ATL-HPA042886-25
  • Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family A (ABC1), member 2
Gene Name: ABCA2
Alternative Gene Name: ABC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026944: 91%, ENSRNOG00000014268: 89%
Entrez Gene ID: 20
Uniprot ID: Q9BZC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTISVKEAFYTAAPLTSAGILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPSLGSELEALRQHLEALSAGPGTSGSHLDRSTVSSFSLDSV
Gene Sequence PTISVKEAFYTAAPLTSAGILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPSLGSELEALRQHLEALSAGPGTSGSHLDRSTVSSFSLDSV
Gene ID - Mouse ENSMUSG00000026944
Gene ID - Rat ENSRNOG00000014268
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ABCA2 pAb (ATL-HPA042886)
Datasheet Anti ABCA2 pAb (ATL-HPA042886) Datasheet (External Link)
Vendor Page Anti ABCA2 pAb (ATL-HPA042886) at Atlas Antibodies

Documents & Links for Anti ABCA2 pAb (ATL-HPA042886)
Datasheet Anti ABCA2 pAb (ATL-HPA042886) Datasheet (External Link)
Vendor Page Anti ABCA2 pAb (ATL-HPA042886)