Anti ABCA13 pAb (ATL-HPA063601)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063601-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ABCA13
Alternative Gene Name: FLJ33876, FLJ33951
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004668: 69%, ENSRNOG00000025645: 67%
Entrez Gene ID: 154664
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DWLPLNQTFSQVSELVLNVTISTLTFLQQHGVAVTEPVYHLSMQNIVWDPQKVQYDLKSQFGFDDLHTEQILNSSAELKEIPTDTSLEKMVCSV |
| Gene Sequence | DWLPLNQTFSQVSELVLNVTISTLTFLQQHGVAVTEPVYHLSMQNIVWDPQKVQYDLKSQFGFDDLHTEQILNSSAELKEIPTDTSLEKMVCSV |
| Gene ID - Mouse | ENSMUSG00000004668 |
| Gene ID - Rat | ENSRNOG00000025645 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABCA13 pAb (ATL-HPA063601) | |
| Datasheet | Anti ABCA13 pAb (ATL-HPA063601) Datasheet (External Link) |
| Vendor Page | Anti ABCA13 pAb (ATL-HPA063601) at Atlas Antibodies |
| Documents & Links for Anti ABCA13 pAb (ATL-HPA063601) | |
| Datasheet | Anti ABCA13 pAb (ATL-HPA063601) Datasheet (External Link) |
| Vendor Page | Anti ABCA13 pAb (ATL-HPA063601) |
| Citations for Anti ABCA13 pAb (ATL-HPA063601) – 1 Found |
| Nakato, Mitsuhiro; Shiranaga, Naoko; Tomioka, Maiko; Watanabe, Hitomi; Kurisu, Junko; Kengaku, Mineko; Komura, Naoko; Ando, Hiromune; Kimura, Yasuhisa; Kioka, Noriyuki; Ueda, Kazumitsu. ABCA13 dysfunction associated with psychiatric disorders causes impaired cholesterol trafficking. The Journal Of Biological Chemistry. 2021;296( 33478937):100166. PubMed |