Anti ABCA10 pAb (ATL-HPA014535)

Atlas Antibodies

Catalog No.:
ATL-HPA014535-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family A (ABC1), member 10
Gene Name: ABCA10
Alternative Gene Name: EST698739
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044749: 59%, ENSRNOG00000046890: 60%
Entrez Gene ID: 10349
Uniprot ID: Q8WWZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MYKVTRETHCWEFSPSMYFLSLEQIPKTPLTSLLIVNNTGSNIEDLVHSLKCQDIVLEIDDFRNRNGSDDPSYNGAIIVSGDQKDYRFSVACNTKKLNC
Gene Sequence MYKVTRETHCWEFSPSMYFLSLEQIPKTPLTSLLIVNNTGSNIEDLVHSLKCQDIVLEIDDFRNRNGSDDPSYNGAIIVSGDQKDYRFSVACNTKKLNC
Gene ID - Mouse ENSMUSG00000044749
Gene ID - Rat ENSRNOG00000046890
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABCA10 pAb (ATL-HPA014535)
Datasheet Anti ABCA10 pAb (ATL-HPA014535) Datasheet (External Link)
Vendor Page Anti ABCA10 pAb (ATL-HPA014535) at Atlas Antibodies

Documents & Links for Anti ABCA10 pAb (ATL-HPA014535)
Datasheet Anti ABCA10 pAb (ATL-HPA014535) Datasheet (External Link)
Vendor Page Anti ABCA10 pAb (ATL-HPA014535)