Anti ABCA1 pAb (ATL-HPA057283)

Atlas Antibodies

Catalog No.:
ATL-HPA057283-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family A (ABC1), member 1
Gene Name: ABCA1
Alternative Gene Name: ABC1, HDLDT1, TGD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015243: 85%, ENSRNOG00000018126: 84%
Entrez Gene ID: 19
Uniprot ID: O95477
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLPWVQGIICNANNPCFRYPTPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELC
Gene Sequence TLPWVQGIICNANNPCFRYPTPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELC
Gene ID - Mouse ENSMUSG00000015243
Gene ID - Rat ENSRNOG00000018126
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ABCA1 pAb (ATL-HPA057283)
Datasheet Anti ABCA1 pAb (ATL-HPA057283) Datasheet (External Link)
Vendor Page Anti ABCA1 pAb (ATL-HPA057283) at Atlas Antibodies

Documents & Links for Anti ABCA1 pAb (ATL-HPA057283)
Datasheet Anti ABCA1 pAb (ATL-HPA057283) Datasheet (External Link)
Vendor Page Anti ABCA1 pAb (ATL-HPA057283)