Anti ABCA1 pAb (ATL-HPA057283)

Atlas Antibodies

Catalog No.: ATL-HPA057283-25

Protein Description: ATP-binding cassette, sub-family A (ABC1), member 1
Gene Name: ABCA1
Alternative Gene Name: ABC1, HDLDT1, TGD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015243: 85%, ENSRNOG00000018126: 84%
Entrez Gene ID: 19
Uniprot ID: O95477
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLPWVQGIICNANNPCFRYPTPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELC
• Gene Sequence: TLPWVQGIICNANNPCFRYPTPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELC
• Gene ID - Mouse: ENSMUSG00000015243
• Gene ID - Rat: ENSRNOG00000018126
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.