Anti ABAT pAb (ATL-HPA041690 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041690-25

• 
• 

Protein Description: 4-aminobutyrate aminotransferase
Gene Name: ABAT
Alternative Gene Name: GABAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057880: 90%, ENSRNOG00000002636: 92%
Entrez Gene ID: 18
Uniprot ID: P80404
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVEFDYDGPLMKTEVPGPRSQELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQNASMFVNRPALGILPPENFVEKLRQS
• Gene Sequence: DVEFDYDGPLMKTEVPGPRSQELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQNASMFVNRPALGILPPENFVEKLRQS
• Gene ID - Mouse: ENSMUSG00000057880
• Gene ID - Rat: ENSRNOG00000002636
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ABAT pAb (ATL-HPA041690 w/enhanced validation) – 1 Found

Jansen, Maurice P H M; Sas, Leen; Sieuwerts, Anieta M; Van Cauwenberghe, Caroline; Ramirez-Ardila, Diana; Look, Maxime; Ruigrok-Ritstier, Kirsten; Finetti, Pascal; Bertucci, François; Timmermans, Mieke M; van Deurzen, Carolien H M; Martens, John W M; Simon, Iris; Roepman, Paul; Linn, Sabine C; van Dam, Peter; Kok, Marleen; Lardon, Filip; Vermeulen, Peter B; Foekens, John A; Dirix, Luc; Berns, Els M J J; Van Laere, Steven. Decreased expression of ABAT and STC2 hallmarks ER-positive inflammatory breast cancer and endocrine therapy resistance in advanced disease. Molecular Oncology. 2015;9(6):1218-33.