Anti AATF pAb (ATL-HPA004940)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004940-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: AATF
Alternative Gene Name: BFR2, CHE-1, CHE1, DED
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018697: 72%, ENSRNOG00000002778: 66%
Entrez Gene ID: 26574
Uniprot ID: Q9NY61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLTSLVGLQ |
| Gene Sequence | SVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLTSLVGLQ |
| Gene ID - Mouse | ENSMUSG00000018697 |
| Gene ID - Rat | ENSRNOG00000002778 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AATF pAb (ATL-HPA004940) | |
| Datasheet | Anti AATF pAb (ATL-HPA004940) Datasheet (External Link) |
| Vendor Page | Anti AATF pAb (ATL-HPA004940) at Atlas Antibodies |
| Documents & Links for Anti AATF pAb (ATL-HPA004940) | |
| Datasheet | Anti AATF pAb (ATL-HPA004940) Datasheet (External Link) |
| Vendor Page | Anti AATF pAb (ATL-HPA004940) |
| Citations for Anti AATF pAb (ATL-HPA004940) – 1 Found |
| Fagerberg, Linn; Stadler, Charlotte; Skogs, Marie; Hjelmare, Martin; Jonasson, Kalle; Wiking, Mikaela; Abergh, Annica; Uhlén, Mathias; Lundberg, Emma. Mapping the subcellular protein distribution in three human cell lines. Journal Of Proteome Research. 2011;10(8):3766-77. PubMed |