Anti AATF pAb (ATL-HPA004940)

Atlas Antibodies

Catalog No.: ATL-HPA004940-25

Protein Description: apoptosis antagonizing transcription factor
Gene Name: AATF
Alternative Gene Name: BFR2, CHE-1, CHE1, DED
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018697: 72%, ENSRNOG00000002778: 66%
Entrez Gene ID: 26574
Uniprot ID: Q9NY61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLTSLVGLQ
• Gene Sequence: SVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLTSLVGLQ
• Gene ID - Mouse: ENSMUSG00000018697
• Gene ID - Rat: ENSRNOG00000002778
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AATF pAb (ATL-HPA004940) – 1 Found

Fagerberg, Linn; Stadler, Charlotte; Skogs, Marie; Hjelmare, Martin; Jonasson, Kalle; Wiking, Mikaela; Abergh, Annica; Uhlén, Mathias; Lundberg, Emma. Mapping the subcellular protein distribution in three human cell lines. Journal Of Proteome Research. 2011;10(8):3766-77.