Anti AASDH pAb (ATL-HPA036473)

Atlas Antibodies

SKU:
ATL-HPA036473-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic and membranous positivity in hepatocytes.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aminoadipate-semialdehyde dehydrogenase
Gene Name: AASDH
Alternative Gene Name: ACSF4, LYS2, NRPS998
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055923: 39%, ENSRNOG00000002137: 40%
Entrez Gene ID: 132949
Uniprot ID: Q4L235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKLSDINQEEASGTSLHQKAIMTFTCHNEINAFVVLSRGSQILSLNSTRFLTKLGHCSSACPSDSVSQTNIQNLKGLNSPVLIGKSKDPSCV
Gene Sequence RKLSDINQEEASGTSLHQKAIMTFTCHNEINAFVVLSRGSQILSLNSTRFLTKLGHCSSACPSDSVSQTNIQNLKGLNSPVLIGKSKDPSCV
Gene ID - Mouse ENSMUSG00000055923
Gene ID - Rat ENSRNOG00000002137
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AASDH pAb (ATL-HPA036473)
Datasheet Anti AASDH pAb (ATL-HPA036473) Datasheet (External Link)
Vendor Page Anti AASDH pAb (ATL-HPA036473) at Atlas Antibodies

Documents & Links for Anti AASDH pAb (ATL-HPA036473)
Datasheet Anti AASDH pAb (ATL-HPA036473) Datasheet (External Link)
Vendor Page Anti AASDH pAb (ATL-HPA036473)