Anti AARS2 pAb (ATL-HPA035636)

Atlas Antibodies

Catalog No.:
ATL-HPA035636-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: alanyl-tRNA synthetase 2, mitochondrial
Gene Name: AARS2
Alternative Gene Name: AARSL, bA444E17.1, KIAA1270
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023938: 76%, ENSRNOG00000025808: 81%
Entrez Gene ID: 57505
Uniprot ID: Q5JTZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen THLLNWALRQTLGPGTEQQGSHLNPEQLRLDVTTQTPLTPEQLRAVENTVQEAVGQDEAVYMEEVPLALTAQVP
Gene Sequence THLLNWALRQTLGPGTEQQGSHLNPEQLRLDVTTQTPLTPEQLRAVENTVQEAVGQDEAVYMEEVPLALTAQVP
Gene ID - Mouse ENSMUSG00000023938
Gene ID - Rat ENSRNOG00000025808
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AARS2 pAb (ATL-HPA035636)
Datasheet Anti AARS2 pAb (ATL-HPA035636) Datasheet (External Link)
Vendor Page Anti AARS2 pAb (ATL-HPA035636) at Atlas Antibodies

Documents & Links for Anti AARS2 pAb (ATL-HPA035636)
Datasheet Anti AARS2 pAb (ATL-HPA035636) Datasheet (External Link)
Vendor Page Anti AARS2 pAb (ATL-HPA035636)
Citations for Anti AARS2 pAb (ATL-HPA035636) – 1 Found
Hilander, Taru; Zhou, Xiao-Long; Konovalova, Svetlana; Zhang, Fu-Ping; Euro, Liliya; Chilov, Dmitri; Poutanen, Matti; Chihade, Joseph; Wang, En-Duo; Tyynismaa, Henna. Editing activity for eliminating mischarged tRNAs is essential in mammalian mitochondria. Nucleic Acids Research. 2018;46(2):849-860.  PubMed