Anti AARS2 pAb (ATL-HPA035636)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035636-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AARS2
Alternative Gene Name: AARSL, bA444E17.1, KIAA1270
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023938: 76%, ENSRNOG00000025808: 81%
Entrez Gene ID: 57505
Uniprot ID: Q5JTZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | THLLNWALRQTLGPGTEQQGSHLNPEQLRLDVTTQTPLTPEQLRAVENTVQEAVGQDEAVYMEEVPLALTAQVP |
Gene Sequence | THLLNWALRQTLGPGTEQQGSHLNPEQLRLDVTTQTPLTPEQLRAVENTVQEAVGQDEAVYMEEVPLALTAQVP |
Gene ID - Mouse | ENSMUSG00000023938 |
Gene ID - Rat | ENSRNOG00000025808 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AARS2 pAb (ATL-HPA035636) | |
Datasheet | Anti AARS2 pAb (ATL-HPA035636) Datasheet (External Link) |
Vendor Page | Anti AARS2 pAb (ATL-HPA035636) at Atlas Antibodies |
Documents & Links for Anti AARS2 pAb (ATL-HPA035636) | |
Datasheet | Anti AARS2 pAb (ATL-HPA035636) Datasheet (External Link) |
Vendor Page | Anti AARS2 pAb (ATL-HPA035636) |
Citations for Anti AARS2 pAb (ATL-HPA035636) – 1 Found |
Hilander, Taru; Zhou, Xiao-Long; Konovalova, Svetlana; Zhang, Fu-Ping; Euro, Liliya; Chilov, Dmitri; Poutanen, Matti; Chihade, Joseph; Wang, En-Duo; Tyynismaa, Henna. Editing activity for eliminating mischarged tRNAs is essential in mammalian mitochondria. Nucleic Acids Research. 2018;46(2):849-860. PubMed |