Anti AARS pAb (ATL-HPA040870 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA040870-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: alanyl-tRNA synthetase
Gene Name: AARS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031960: 98%, ENSRNOG00000018404: 98%
Entrez Gene ID: 16
Uniprot ID: P49588
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen DRASKADVQKRVLEKTKQFIDSNPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKD
Gene Sequence DRASKADVQKRVLEKTKQFIDSNPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKD
Gene ID - Mouse ENSMUSG00000031960
Gene ID - Rat ENSRNOG00000018404
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AARS pAb (ATL-HPA040870 w/enhanced validation)
Datasheet Anti AARS pAb (ATL-HPA040870 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AARS pAb (ATL-HPA040870 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AARS pAb (ATL-HPA040870 w/enhanced validation)
Datasheet Anti AARS pAb (ATL-HPA040870 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AARS pAb (ATL-HPA040870 w/enhanced validation)