Anti AANAT pAb (ATL-HPA054321)

Atlas Antibodies

Catalog No.:
ATL-HPA054321-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aralkylamine N-acetyltransferase
Gene Name: AANAT
Alternative Gene Name: SNAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020804: 89%, ENSRNOG00000011182: 89%
Entrez Gene ID: 15
Uniprot ID: Q16613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAHLHVLAVHRAFRQQGRGPILLWR
Gene Sequence FLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAHLHVLAVHRAFRQQGRGPILLWR
Gene ID - Mouse ENSMUSG00000020804
Gene ID - Rat ENSRNOG00000011182
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AANAT pAb (ATL-HPA054321)
Datasheet Anti AANAT pAb (ATL-HPA054321) Datasheet (External Link)
Vendor Page Anti AANAT pAb (ATL-HPA054321) at Atlas Antibodies

Documents & Links for Anti AANAT pAb (ATL-HPA054321)
Datasheet Anti AANAT pAb (ATL-HPA054321) Datasheet (External Link)
Vendor Page Anti AANAT pAb (ATL-HPA054321)