Anti AAMP pAb (ATL-HPA031868)

Atlas Antibodies

Catalog No.:
ATL-HPA031868-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: angio-associated, migratory cell protein
Gene Name: AAMP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006299: 98%, ENSRNOG00000014399: 98%
Entrez Gene ID: 14
Uniprot ID: Q13685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMP
Gene Sequence RIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMP
Gene ID - Mouse ENSMUSG00000006299
Gene ID - Rat ENSRNOG00000014399
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AAMP pAb (ATL-HPA031868)
Datasheet Anti AAMP pAb (ATL-HPA031868) Datasheet (External Link)
Vendor Page Anti AAMP pAb (ATL-HPA031868) at Atlas Antibodies

Documents & Links for Anti AAMP pAb (ATL-HPA031868)
Datasheet Anti AAMP pAb (ATL-HPA031868) Datasheet (External Link)
Vendor Page Anti AAMP pAb (ATL-HPA031868)