Anti AAMDC pAb (ATL-HPA037918 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037918-25

Protein Description: adipogenesis associated, Mth938 domain containing
Gene Name: AAMDC
Alternative Gene Name: C11orf67, CK067, FLJ21035, PTD015
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035642: 89%, ENSRNOG00000012584: 89%
Entrez Gene ID: 28971
Uniprot ID: Q9H7C9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEK
• Gene Sequence: EIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEK
• Gene ID - Mouse: ENSMUSG00000035642
• Gene ID - Rat: ENSRNOG00000012584
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.