Anti AAMDC pAb (ATL-HPA037918 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA037918-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: adipogenesis associated, Mth938 domain containing
Gene Name: AAMDC
Alternative Gene Name: C11orf67, CK067, FLJ21035, PTD015
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035642: 89%, ENSRNOG00000012584: 89%
Entrez Gene ID: 28971
Uniprot ID: Q9H7C9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEK
Gene Sequence EIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEK
Gene ID - Mouse ENSMUSG00000035642
Gene ID - Rat ENSRNOG00000012584
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AAMDC pAb (ATL-HPA037918 w/enhanced validation)
Datasheet Anti AAMDC pAb (ATL-HPA037918 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AAMDC pAb (ATL-HPA037918 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AAMDC pAb (ATL-HPA037918 w/enhanced validation)
Datasheet Anti AAMDC pAb (ATL-HPA037918 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AAMDC pAb (ATL-HPA037918 w/enhanced validation)